SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006269 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006269
Domain Number 1 Region: 13-318
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.46e-31
Family FAD/NAD-linked reductases, N-terminal and central domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006269   Gene: ENSTTRG00000006624   Transcript: ENSTTRT00000006624
Sequence length 373
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_471:60199:67701:-1 gene:ENSTTRG00000006624 transcript:ENSTTRT00000006624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQVSMDVGAVHVVIVGGGFGGIAAASQLQVLNIPFVLVDMKDSFHHNVAALRASVESG
FAKKTFISYSVTFKENFRQGLVVEIDLKNQTVLLEDGEALSFTYLILATGSTGLFPGKFN
QVSSQQMAIQAYEDMVTQVQCAQSIVVIGGGSAGVEMAAEIKTEYPEKEVTLIHSRMALA
DKELLPCVRQEVKEILLRKGVQLLLSERVSNLEALPLNKHREHITVQTDKGTEVAANLVI
ACSGIKINSSAYSSAFGDQLASDGALRVNEYLQVEGYSHIYAIGDCADVREPKMAYHASL
HASVAVANIVNSMKQRPLKAYKPGSLTFLLAMGRNDGVGQISGFYVGRLMVRLAKSRDLL
VSTSWKTMRQSPP
Download sequence
Identical sequences ENSTTRP00000006269 ENSTTRP00000006269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]