SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006289 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006289
Domain Number 1 Region: 3-205
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.31e-58
Family Proteasome subunits 0.00000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006289   Gene: ENSTTRG00000006651   Transcript: ENSTTRT00000006646
Sequence length 205
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_737:66301:76179:1 gene:ENSTTRG00000006651 transcript:ENSTTRT00000006646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTEDFVVSGTCTEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAV
SGMGVIVHIIEKDKITTRTLKARMD
Download sequence
Identical sequences XP_004282754.1.21590 ENSTTRP00000006289 ENSTTRP00000006289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]