SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006297 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006297
Domain Number 1 Region: 794-895
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-25
Family Ankyrin repeat 0.00044
Further Details:      
 
Domain Number 2 Region: 8-106
Classification Level Classification E-value
Superfamily BRCT domain 1.15e-18
Family BRCT domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006297   Gene: ENSTTRG00000006649   Transcript: ENSTTRT00000006654
Sequence length 895
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3595:418973:470798:1 gene:ENSTTRG00000006649 transcript:ENSTTRT00000006654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGAPKHIIQMTGFKMEEKEALGKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAA
CAAGKWVLTKDYIIHSAKSGKWLDETTYEWGYKIEKDSHYSPQMQSAPKRWREELKRTGA
PGAFHRWKVVLLVRADKRSDSLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXKEIQNDEDSQTSSVWNNHSNQEKNKDFRKDMGFLEMKGALKE
IMCRTQKEVKNHDEDVNISSILTEHHRKEKYRDSSKDLKFVKMRNALGRHTYGNQKGIKK
KDEDIQRNYTLRKKHKREKERDSRKDNEHDKITVRKHIYRDQKEMKNSVFADHAKESKTK
DIRTDVDIADIKNALRKHIYRAQAIRYSCIRIDKQPAYNVEVKNAEFPRGVLNLIESLIE
GQFFKEAIEELSSLQSHYIPPVCLLHALLENILQDNIDTFSGRYFHILSALLHLHPPWKS
PAMSRYYLELFQCPTCMKGAWSLIEVLIRSCLFSESFCHQISENIIGSKLLHLTLLKFFF
NLVKSEVRHLSQKLYDWSDSQSLKITGKAVLLEIFWSGSETSGLLTKPINMLLEWTIYSH
KEKCKSSDVFKHELAYLLTGILGAAIDYWIVLGLKMGRNVMRHMSDDLGSYVSLSCDDFS
SQELEIFICSFSSSWLQMFVAEAVFKKLCLQSSISISSEPLSLQKMVYSYLPALGKTGVH
GTGKMQIPKKIGQRPCFESQRALIMLNGAKQKQVEGLPELPELNLAKCSSSLKRLKKKSE
GELSCSKENCPSLVTKINHKTNKGETALHRACINNQVEKLILLLSMPGIDINVKDNAGWT
PLHEACNYGNTVCVQEILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHG
Download sequence
Identical sequences ENSTTRP00000006297 ENSTTRP00000006297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]