SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006299 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006299
Domain Number 1 Region: 4-129
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.58e-53
Family Inorganic pyrophosphatase 0.00000871
Further Details:      
 
Domain Number 2 Region: 171-284
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.88e-26
Family Inorganic pyrophosphatase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006299   Gene: ENSTTRG00000006655   Transcript: ENSTTRT00000006656
Sequence length 288
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_471:118550:156727:-1 gene:ENSTTRG00000006655 transcript:ENSTTRT00000006656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSSEERAAPFTLEYRVFLKNERGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPRHNDEHTGCCGDNDPI
DVCEIGSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINDVKRLKP
GYLEATVDWFRRYKVPDGKPENQFAFDAEFKDKDFAIDIIKSTHDYWRALVTKKTDGKGI
SCMNTTVFESPFQCDPDAAKAIVEALPPHEPACTIPTDVDKWFHHQKN
Download sequence
Identical sequences ENSTTRP00000006299 ENSTTRP00000006299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]