SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006356 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006356
Domain Number 1 Region: 277-464
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.19e-42
Family cAMP-binding domain 0.00021
Further Details:      
 
Domain Number 2 Region: 28-268
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.89e-30
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006356   Gene: ENSTTRG00000006723   Transcript: ENSTTRT00000006718
Sequence length 575
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2996:92892:97734:1 gene:ENSTTRG00000006723 transcript:ENSTTRT00000006718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQDSKVKTTESSSSAPPKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLIIVVCRACFPD
LQRYYLVAWLVLDCTSDLLYLLDIVVRFHTGFLEQGILVVDGRISSRYVRTWSFFLDLAS
LLPTEVAYVSLGPHTPTLRLNRFLRVPRLSEAFDRMETCTVHPNAFRIAKLMLYVFAVIH
WNSCLYFALSRYLGFGSDAWVYPDPAQPGFEQLWRQYLYSFHFSTLILTTVGDTPLPDRE
EEYLFVVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLHHVNRRLQR
RVMDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLPTLSRVRIFQNCEAGLLEELV
LKLQPQTYSPGKYVCRKGDTGQEMYIIREGQLAVVADDGVTQYAVLGAGLYFGEISIIDI
KGNMSGNRPTANIKSLGYSDLFCLSKEDLQEVLSEYPQAQAVMEEKGREILLTMNKLDVN
AEAAETALQEATEAQLRGLDQQLDDLQTGFARLLAELESRALKIAYRIERQEWQTQEWPM
PEELAEADHEGEPGEETSKDGEGRAGQEGPPSPEG
Download sequence
Identical sequences ENSTTRP00000006356 ENSTTRP00000006356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]