SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006443 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006443
Domain Number 1 Region: 266-409
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.76e-33
Family cAMP-binding domain 0.000000208
Further Details:      
 
Domain Number 2 Region: 132-263
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.89e-33
Family cAMP-binding domain 0.000000172
Further Details:      
 
Domain Number 3 Region: 2-30
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000837
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006443   Gene: ENSTTRG00000006807   Transcript: ENSTTRT00000006813
Sequence length 415
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_18:49773:161184:1 gene:ENSTTRG00000006807 transcript:ENSTTRT00000006813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIEIPARLTELLQGFTVEVLRHQPGDLQEVTQQSTRLQEEDERKGNARVGHEGRTGGDP
GAAGGGGTPSKEVNFAEEPMHSGSENGEEEEATDAGAFNXXXXXXXXXXXXXCAEAYNPD
EEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVID
QGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGA
LWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQI
IAQGDLADSFFIVESGEVKITMKRKGKSEAEENGAVEIARCSRGQYFGELALVTNKPRAA
SAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Download sequence
Identical sequences ENSTTRP00000006443 ENSTTRP00000006443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]