SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006467 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006467
Domain Number 1 Region: 524-555,605-679
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000116
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006467   Gene: ENSTTRG00000006840   Transcript: ENSTTRT00000006841
Sequence length 727
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_18:649792:679226:-1 gene:ENSTTRG00000006840 transcript:ENSTTRT00000006841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPIGNQYVVARPVYSTKAFDEEHKKKHRHHKTLLDHLKTWFRCSAQKAKRIALSLFPI
ASWLPAYRIKEWLLSDIVSGISTGLVAVLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXPFPVLSMMVGAVVVRLTPIADTADPTVTNSSVANDSSLDDHKVMVAATVTIL
SGIIQLLMGVLQLGFVVIYLSESLISGFTTAAAVHVLVSQLKFILQLTVPAHADPFSIFK
VLTSIFSQIEKTNIADLVTSLVILLVVFVVKEINQRYKAKLPVPIPIELIMTVIATAVSY
GFDFKNRFNVAVVGEMESGFQAPIAPNVQTFRDTIGDCFGIAIVGFAVAFSVASVYSLKY
DYPIDGNQELIALGVSNIFGGSFRGFAASTALSRSGVQESTGGKTQVAGLLSAVIVLIVI
LAIGFLLEPLQKSVLAALALGNLKGMLMQFTEIRRLWRKDKYDCLIWVMTFIFAVVLGLG
LGLAASVALQLLTIVFRTQFPKCSTLANVGRSNIYKNRKDYSEMYEPDGVKIFRCPSPIY
FANISFFKQKLIDAKGYICTVDGFKDSDEELDNDNIEELDQPINTTDLPFQIDWNADLPF
NIMVPKINLHSLILDFSAVSFLDISSMRGLKMILQEFIRIQVDVYIVGTDDDFIEKLARC
EFFDDEVKDSIFFLTIHDAVLHILMKKDYSTSKFNPSQEKEAKFDFTINTNGALRNRECQ
VPSETKF
Download sequence
Identical sequences ENSTTRP00000006467 ENSTTRP00000006467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]