SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006559 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006559
Domain Number 1 Region: 39-284
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.46e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000043
Further Details:      
 
Domain Number 2 Region: 285-482
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.48e-44
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00015
Further Details:      
 
Domain Number 3 Region: 620-797
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.71e-31
Family AlaX-like 0.028
Further Details:      
 
Domain Number 4 Region: 545-620
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000494
Family AlaX-M N-terminal domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006559   Gene: ENSTTRG00000006938   Transcript: ENSTTRT00000006936
Sequence length 985
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1482:112298:124804:-1 gene:ENSTTRG00000006938 transcript:ENSTTRT00000006936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSVAAAAGRLRRAIRRTPQWRGPSRRALSSEAPPTQAAAVRDAFLSFFRDRHGHRLVP
SASVRPRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGRHSDLED
VGRDLSHHTFFEMLGNWAFRGVYFKEEACSMAWELLTQVYGIPEDRLWVSYFGGDPKAGL
GPDLESRDIWLKLGVPASRMLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGVGAPQLVEL
WNLVFMQHNREKDGSLQPLPQRHVDTGMGLERLLAVLQGRRSTYDTDLFSPLLNAIHQGC
GAPPYSGRVGAADEGHTDTAYRVVADHIRTLSICIADGVSPGMSGAPLVLRRLLRRAVRF
STELLRAPPGFLGSLVPVVVETLGGAYPELQRNSAQIASLVSEDEAAFLASLQQGRRIIE
RTVRRLGPSDVFPAEVAWSLSLSGNLGLPLDLVKLMLEEKGVQLDSAGLERLAQEEAQHR
AQQAEPVQEQGLRLDVHALGALQRQGVPPTDDSPKYNYSLRPSGGYEFGTCEAQVLQLYT
EDGTAVASVGEGQRCGLLLDKTNFYAEQGGQASDRGYLVRVGLQDVLFPVARAQVCGGFI
LHEVAAPECLKVGDQVQLHVDEAWRLSCMEKHTAVHLLNWALRQALGPGTEQRGSHLNPE
WLRFDVATQAPLTPEQLRAVEGTVQKAVGQDEAVYMEEVALARTAHVPGLRSLDEVYPDP
VRVVSVGVPVAQALNPASQAALQTSVELCCGTHLLRTGAIGDLVIIGERQLAKGTTRLLA
ITGEQAQQAREVGQSLAQEVEAAAARLSQGSRDVVEAQRLSKEMGRLIDAVDTAVMPQWQ
RRELQATLKALRRRANTAVRKLEMGQAAQKTQELLQQHSEGPLIVDTVYAESLSVLVKVV
RQLCKQAPSTSVLLLSPQPLGQVLCACQVAQSATPAFTAEAWALAVCSHMGGKAWGSRVV
AQGTGSTADLDAALSTARAYALNKL
Download sequence
Identical sequences ENSTTRP00000006559 ENSTTRP00000006559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]