SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006664 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006664
Domain Number 1 Region: 288-376
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 3.92e-37
Family Small-conductance potassium channel 0.0000716
Further Details:      
 
Domain Number 2 Region: 190-334
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.36e-25
Family Voltage-gated potassium channels 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006664   Gene: ENSTTRG00000007048   Transcript: ENSTTRT00000007044
Sequence length 428
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_635:8014:19793:-1 gene:ENSTTRG00000007048 transcript:ENSTTRT00000007044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGELVPGLGALRRRKHLLEQERSLAGWALALAGIGIGLMVLHAEMLWFGGCLWAIHLFL
VKCMISISTFSLLSLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELAVCALHPA
PVWRPPCAQISGSPQTAVTQSWPSFLGQAEALLSLAMLLRLYLVPRALLLRSGVLLNASY
RSIGALNQVRFRHWFVAKLYMNTHPGRLLLCLTLGLWLTTAWVLSVAERQTVNATGHLSD
TLWLIPITFLTIGYGDVVPGTTWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVH
NFMMDIQYTKEMKESAARVLQESWMFYKHTRRKDSGAARRHQRRLLAAINSFRQVRLKHR
KLREKVNSMVDISKMHMILCDLQLGLSTSHQALEKQIDALAGKLDTLTELLSAALGPRQL
PEPSQEAT
Download sequence
Identical sequences ENSTTRP00000006664 ENSTTRP00000006664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]