SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006759 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006759
Domain Number 1 Region: 381-670,752-794
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.99e-70
Family FAD-linked reductases, N-terminal domain 0.00047
Further Details:      
 
Domain Number 2 Region: 271-377
Classification Level Classification E-value
Superfamily Homeodomain-like 8.15e-20
Family SWIRM domain 0.014
Further Details:      
 
Domain Number 3 Region: 655-742
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000000000785
Family L-aminoacid/polyamine oxidase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006759   Gene: ENSTTRG00000007141   Transcript: ENSTTRT00000007143
Sequence length 795
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1487:440214:491458:1 gene:ENSTTRG00000007141 transcript:ENSTTRT00000007143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPRGRTKKKAPFDHLXXXXXXXXXXXXXVKKKATETADEDEDGGSEKKYRKCEKAGCT
AACPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTS
NGKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIARTYRCGMKPNTAVKP
ETSDHCSLPEDLRVSEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTHR
TASDASPGKLEHSKAVPCVLVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEYS
RDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGL
INTGVLTVGTDQHLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRV
WDDKSFTGVTVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTIDK
RMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFINESGIQFSELEEEVLQFHLS
NLEYACGSSLHQVSARSWDHNEFFAQFAGDHTLLTLGYSVILEKLTEGLDIRLRSPQVKS
IDYSGDEVQVTTTDGTECTAQKVLVTVPLALLQKGSLQFNPPLSDKKMKAINSLGAGIIE
KIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQQHCRAIILQKMLKKEVP
DPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDILAEEIQGTIFFAGEATNRHFPQTVTG
AYLSGVREASKIAAF
Download sequence
Identical sequences ENSTTRP00000006759 ENSTTRP00000006759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]