SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006812 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006812
Domain Number 1 Region: 368-723
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.84e-101
Family Hect, E3 ligase catalytic domain 0.0000000866
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000006812
Domain Number - Region: 102-152
Classification Level Classification E-value
Superfamily Globin-like 0.00216
Family Globins 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006812   Gene: ENSTTRG00000007198   Transcript: ENSTTRT00000007198
Sequence length 729
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2429:8404:70564:1 gene:ENSTTRG00000007198 transcript:ENSTTRT00000007198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLDRGSKGQISTSSSFVSTVNQKKEAAENRSSPTHLVFPNIKNVRDLPPICLDVRQKQRT
STDALSSEMKTPVLPEPILPVQPKTMKDFLEDVEKAKSSGDWKTVHDFYLTMFDSFPELN
AAFKKDASASFNTIEDSGINAKFVNAVYDALLNTPQDIQKTVLKGIINSLLREWKGPRTK
DDLRAYFILLQNPQFNNTSTYVIYAHLLRQIATLVEADHHFLVHWFKKLSQKRFKQLVER
LLQFISLRLFPAKPEEFPPISKCSWWIPSASKVLALLNTANNLVHPPLIPYTDFYNSTLD
HIDLMEEYHTWQSFGNSHRFSFCQYPFVISIAAKKIIIQRDSEQQMISIARQSLVDKVSR
RQRPDMNMLFLNMKVRRTHLVSDSLDELTRKRADLKKKLKVTFVGEAGLDMGGLTKEWFL
LLIRQIFHPDYSMFTYHKDSYCHWFSSFKCDNYSEFRLVGILMGLAVYNSITLDIFPPCC
YKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELAHGLSELLSYEGNVEEDFYSTFQVF
QEEFGIIKSYNLKPGGDKIAVTNQNRKEYVQLYIDFLLNKSIYKQFAAFYYGFHSVCASN
ALMLLRPEEVEILVCGSPELDMHALQRSTQYDGYAKTDLTIRYFWDVVLGFPLDLQKKLL
HFTTGSDRVPVGGMADLNFKISKNETSTNWLPVAHTCFNQLCLPPYKSKKDLKQKLIIGI
SNSEGFGLE
Download sequence
Identical sequences ENSTTRP00000006812 ENSTTRP00000006812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]