SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006831 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006831
Domain Number 1 Region: 216-280
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.00056
Further Details:      
 
Domain Number 2 Region: 155-219
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000189
Family Complement control module/SCR domain 0.00055
Further Details:      
 
Domain Number 3 Region: 96-166
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000848
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 35-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000958
Family Complement control module/SCR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006831   Gene: ENSTTRG00000007214   Transcript: ENSTTRT00000007217
Sequence length 382
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_969:10442:62334:1 gene:ENSTTRG00000007214 transcript:ENSTTRT00000007217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAPPGRPESPPFPWCCGGILLLSLVLPLPIFSGPCIDPPVMESMKLKGVIKRHYYSGDRI
NYECRIGYFYVWPFSSHTCEPNGSWSPIEEACLRKSCPNPEIKHGEVYAPNKTFEFQKHI
SCNEGYYLRGKSILTCNRIGGNVHWSDKIPHCEKIFCGRPPEIKHGKHTNSYRNIFEYNE
LVTYSCNPSNGSDEYSLVGERQLICSGPGKWSSAAPLCKVVKCERPVLEHGIIVSGSRKK
FSYQAVVIFECLQGFYLNGSNLVFCGGNNTWEPEMPKCIKVLIPLNTKLPILSHSGYKPT
HPTKTPLAKYPGYPSPGDEPPPKDAESLGAGIIVAIVTGTLFGVVVVVGSIYFCFHKEKK
RKEGIATYSACQNKVTTPAEKD
Download sequence
Identical sequences ENSTTRP00000006831 ENSTTRP00000006831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]