SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006832 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006832
Domain Number 1 Region: 175-200,255-462
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-58
Family Voltage-gated potassium channels 0.00061
Further Details:      
 
Domain Number 2 Region: 42-130
Classification Level Classification E-value
Superfamily POZ domain 1.49e-24
Family Tetramerization domain of potassium channels 0.00000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006832   Gene: ENSTTRG00000007221   Transcript: ENSTTRT00000007218
Sequence length 529
Comment pep:novel scaffold:turTru1:scaffold_113062:70269:71964:-1 gene:ENSTTRG00000007221 transcript:ENSTTRT00000007218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEKSLTLAAPGEARGPEGEQQDPGDFPEAGGGGGGCCSSERLVINISGLRFETQLRTL
SLFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFLE
EIRFYQLLGDEALAAFREDEGCLPEGGVDEKPLPSQPFQRQVWLLFEYPESSGPARGIAI
VSVLVILISIVIFCLETLPQFRADGRGGSNGGGVSPVSRGSQEEEEDEDDSYTFHPGITA
GGMVAGGSSPLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNIID
LVAIFPYFITLGTELVQQQGQQSASGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSK
GLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTM
TTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHV
TCGQPAPDLKAADNGLGKPEFSEATRERRPSYFPTPHRAYAEKRMLTEV
Download sequence
Identical sequences ENSTTRP00000006832 ENSTTRP00000006832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]