SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006870 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006870
Domain Number 1 Region: 34-198
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.18e-45
Family Proteasome subunits 0.0000000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006870   Gene: ENSTTRG00000007260   Transcript: ENSTTRT00000007259
Sequence length 248
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1820:337753:394741:-1 gene:ENSTTRG00000007260 transcript:ENSTTRT00000007259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIFARLCCLTGEVEKPASPGLHRTCSPRPPATMEYLIGIQGPDYVLVASDRVAASNIVQM
KDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNL
ADYLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYT
PTISREKAVELLRKCLEEGPGVGWSSTAPGRCRRTSGLDRGSRCLQKAGRRRTLINCPSG
WRCGWIPQ
Download sequence
Identical sequences ENSTTRP00000006870 ENSTTRP00000006870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]