SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006964 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006964
Domain Number 1 Region: 259-497
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.7e-54
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 98-209
Classification Level Classification E-value
Superfamily POZ domain 1.96e-25
Family Tetramerization domain of potassium channels 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006964   Gene: ENSTTRG00000007359   Transcript: ENSTTRT00000007359
Sequence length 545
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1866:159376:177204:1 gene:ENSTTRG00000007359 transcript:ENSTTRT00000007359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKQNERRRSWGYKSWHTTESEGSQQRRRICSVGALPGSQTSFHWTQSYCSYYIDEDTDT
EEDQQWKDDLAEEDQQPGEATTDQGEGGTDAPVVSSTLNVNVGGQSYHLDYAELASYPKT
RLGRLATSTSRSRQLGLCDDYEAQTDEYFFDRDPEIFQLIYNFYASGVLLVRDELCPRRF
LEELGYWGVRLKYAPRCCLICFEERRDELSEQLKIQRELRAQAQAEEAEELFRDMRFYGP
QRRRLWNLMEKPFSSVAAKAIGVASSLFVLISVVALALNTVEEMQQQTGQGAGSGNPQPF
LEHVEMLCMAFFTLEFLLRLASTPDLRRFAQSALNLVDLVAILPLYLQLLLECFTSEDHE
HDLETMGRVGQVGQVLRVMRLLRIFRILKLARHSTGLRAFGFTLRQCYQQVGCLLLFITM
GIFTFSAAVYSVEHDVRGTNFTSIPHAWWWAAVSISTVGYGDMYPETHLGRLFAFLCIAF
GIILNGMPISILYNKFSDYYSKLKAYEYTAIRRERGNVEFMQRARKKIAECLAGSNPQPN
PRQNH
Download sequence
Identical sequences ENSTTRP00000006964 ENSTTRP00000006964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]