SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006969 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006969
Domain Number 1 Region: 9-69
Classification Level Classification E-value
Superfamily Histone-fold 5.09e-17
Family Nucleosome core histones 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006969   Gene: ENSTTRG00000007366   Transcript: ENSTTRT00000007366
Sequence length 103
Comment pep:novel scaffold:turTru1:scaffold_112174:43793:44618:-1 gene:ENSTTRG00000007366 transcript:ENSTTRT00000007366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGAGPLYLAALKYLTEILELAGNAARDNKKTRIIPRHQLAIRNDEELNKLLGKVTIAQGG
VLPNIAVLLPMFGHSGTCSRKRRWLRAGLAGSCLSAHTFQKVK
Download sequence
Identical sequences ENSTTRP00000006969 ENSTTRP00000006969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]