SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006971 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006971
Domain Number 1 Region: 810-1000
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.88e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 506-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-47
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 3 Region: 30-313
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6e-31
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 4 Region: 364-425
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000636
Family L-arabinose binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006971   Gene: ENSTTRG00000007368   Transcript: ENSTTRT00000007368
Sequence length 1073
Comment pep:known_by_projection scaffold:turTru1:scaffold_112174:84927:154496:1 gene:ENSTTRG00000007368 transcript:ENSTTRT00000007368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTPLLALALWSLLLRPGLLFWTSQVSQNCHNGSYEITVLMVNNSAFPESQVNLKDVVNA
GMEIVRQRLLEAGLNVTVNASFINSDGMIYKSSDCRSSTCEGLDLLRTISGTKRMGCVLM
GPTCTYSTFQMYLDTDLKYPMISAGSFGLSCDYKETLTRLMSPARKLTYFLVDFWKVNYL
PFKTFSWNSTYVFKNGTESEDCFWYLNALEAGVSYFSQNLNFKGTLRKDDEFQRILMGQN
RQSNVIVMCGTPDTINILKGDRAVAEDTVIILVDLFNDHYFMDNVTAPDYMKNVLVLTLP
PENPVSNSSFSKNLSLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXRVGPVTLDDCGDIDNTMLLLYTSVDTNKYKVLLTYDTRVNQTYPVDKRPTFIWKNHKL
PKDKPDKGPQMLLVAVFTLTGAVALLLLGALLVLRKYKRDYALRQKKWFHIPPENIFPLE
SNETNHVSLKIDDDKRRDTIQRLRQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQID
YYNLTKFYGTVKLDSMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKG
MSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPRKDLWTAPEHLRQASISQK
GDVYSYGIIAQEIILRRETFYTLSCRDQKEKIFRVEYSNGVKPFRPDLFLETAEEKELEV
YLLVKNCWEEDPEKRPDFKKIENTLAKIFGLFHDQKNETYMDTLIRRLQLYSRNLEHLVE
ERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGIVEPELYEEVTIYFSDIVGFTTICKYS
TPMEVVDMLNDIYKNFDHILDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALDI
LSFMGTFELEHLPGLPIWIRIGIHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPL
RIHVSGSTISILKRTECQFLYEVRGETYLKGRGTETTYWLTGGKDQEYNLPTPPTAESQQ
RLQAEFVDMIASSLQKRQASGIRNRKPTRVASYKKGTLEYLQLNTTDKESTHF
Download sequence
Identical sequences ENSTTRP00000006971 ENSTTRP00000006971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]