SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006980 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006980
Domain Number 1 Region: 63-182,258-363
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.89e-65
Family FabD-like 0.0000802
Further Details:      
 
Domain Number 2 Region: 191-265
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000432
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006980   Gene: ENSTTRG00000007378   Transcript: ENSTTRT00000007377
Sequence length 388
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_492:89913:97941:-1 gene:ENSTTRG00000007378 transcript:ENSTTRT00000007377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVRVARAAWAWGRGVSCRRGASSFLLPPPGAVDVEELLRDATAAEEGPREASVRRLPGQ
CSVLLFPGQGSQVVGMGRGLLRYPRVRELYAAAHRVLGYDLLELSLHGPQEALDRTVHCQ
PAVFVASLAAVEKLHHLQPAVIENCVAAAGFSVGEFAALVFAGAMEFCEGLYAVKIRAEA
MQEASEAVPSGMLSVVGQPQSKFTFACLEAQEHCRTLGIENPVCEVSSYLFPDCRVISGH
LEALQFLQKNSSKYHFRRTKMLPVSGGFHTSLMEPALEPLAQVLKAIDVRKPLVSVHSNV
NGSRYMHPEHIRKLLVRQVVSPVKWEQTMHAVYERKKGTEFPKTFEVGPGKQLGTILKSC
NLQAWRSYSHVEVQEADEDLHNLGPPRW
Download sequence
Identical sequences ENSTTRP00000006980 ENSTTRP00000006980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]