SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007043 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007043
Domain Number 1 Region: 609-721
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.94e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.00045
Further Details:      
 
Domain Number 2 Region: 68-237
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.72e-34
Family G proteins 0.00000182
Further Details:      
 
Domain Number 3 Region: 733-823
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-16
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 344-409,550-594
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000713
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007043   Gene: ENSTTRG00000007444   Transcript: ENSTTRT00000007444
Sequence length 854
Comment pep:novel scaffold:turTru1:scaffold_111703:75225:637156:1 gene:ENSTTRG00000007444 transcript:ENSTTRT00000007444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNS
QEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLL
LIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQD
AISSTNPRVIDDARARKLSSDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSI
GPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPA
ANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKS
LNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPI
SSPKTNGLSKDMSSLHISPNSGNVTSAPGSQMASGVSLGSFNSRPDGMQQRYSVSSADQW
SEATVIANSAISSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKAD
GLSGTADQEENFEFIIVSLTGQTWHFEATYEERDAWVQAIESQILASLQSCESSKNKSRL
TSQSEAMALQSIRNIRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRS
LDLDDWPIELIKVMSSIGNELANSIWEESTQGRTKPSLDSTREEKERWIRAKYEQKLFLA
PLACTELSPGQHLLRATADEDLRTVILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVV
LAQLLIWYGVDVMARDAHGNTALAYARQASSQECTDVLLQYGCPDERFVLMATPNLSRKN
NNRNNSGGRVPTII
Download sequence
Identical sequences ENSTTRP00000007043 ENSTTRP00000007043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]