SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007083 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007083
Domain Number 1 Region: 1011-1126
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.5e-20
Family Regulator of G-protein signaling, RGS 0.0031
Further Details:      
 
Domain Number 2 Region: 839-967
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.24e-18
Family Regulator of G-protein signaling, RGS 0.0057
Further Details:      
 
Domain Number 3 Region: 651-762
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.68e-16
Family Regulator of G-protein signaling, RGS 0.0035
Further Details:      
 
Domain Number 4 Region: 401-503
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000353
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007083   Gene: ENSTTRG00000007486   Transcript: ENSTTRT00000007486
Sequence length 1253
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2407:1056712:1206832:-1 gene:ENSTTRG00000007486 transcript:ENSTTRT00000007486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERRLTAXXXXXXXXXXEDSLATDDFLVDYFNEFLSLPTFSEAIRFNVDYGVFEVVNNA
PQLLEKQLKKILFNQQPRNPIYDVVRKGRSDIKPVQVNAPYEDETISVNYNIMCLNREQG
IHWVKKERLPAFLESDCYFEYRLAKLVSQVRWSESGMNITLGADFSPWVLKKPTSPPPPP
VEEDDVISMKKFCISLGKASYTQTKDWFALAKQNQQTVSTFSLPSCVLHNKIGSPVNSSV
SESFIFDDGVHPRTKKSPSTATRLISEFEEDGPVSLQDTPSQALLRTYLEKQQDVDESLT
LHFSTCEEFLRSYINFILRVAIHQILGAPLRESPDYINFRNVTEVVFDECLGTTSGKNVL
RSEMLKEKLEDMLAQAVSKTESVGLESRANWCISHKTYDIGNRKEFERFKKFIKGTLGER
YWWLWMDIERLKVLKDCGRHQRHIEKMKKCYLVSSGDCYLSAEILSKFKLLDGSQWNEEH
LKNIQTEVVKPLLLYWAPRFCVTHSSSTKHASAELKFWHLRQEKPRKDVDPFPQMATLLP
LRPKSCIPQIPEMQKEESSLLQLSKSLKKPPRVKTAIQKPWKSESLNPVFPKGDVIKKGS
RHMSESSKIICLASFTDISECLKPQLGRRYTYTEEPVIKTMADGALGGFHMENLLQSLYV
ENRAGFFFTKFCENSGNKFWKNSVYFWFDLQAYHQLFYQETIHPFKVCKQAQYLFATYIA
PSATLDIGLQQEKKKEIYMKIQPPFEDLFDTAEEYILLLLLEWTNXXXXXXXXXXXXVEL
VEETRQLNSTYFRKLQALHKETVSKKAEDTTCEIGSGISPLPHVSKQTEYWNNVPAEYRH
FNFNDLLNNKLEFEHFHQFLEAHSSSMDLMCWTDIEQFRRITYRDRKRREAESMYIKNKY
LNKKYFFGPNSPASLYQQDQIMHLSGGWGKILHEQLDAAVLIEIQKHVLNRLENVWLPLF
LASEQFAARQKIKVQVRDIAEELLLQKHERKIGVWKPVESKWISSSCDIIAFRKALLNPI
TARQFQQFVALKGDLLENGVLFWQEVQKYKDLCHSHCSESLIHKKIMTIINCFINSSIPP
ALQIDIPLEQAQKIIEHRKELGPYVFREAQMTIFGVLFKFWPQFCEFRKNLTDKKIMSVL
ERRQEYRKQEKKSVVTEDEKFAKDGIKQYPSTSGSAIKTAALISDPGLGQQAYGQQPTWF
YSKYIEALEQERILLKIQEELERKLFAATPSFTNFKSTASSLKKTISSHNIQK
Download sequence
Identical sequences ENSTTRP00000007083 ENSTTRP00000007083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]