SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007208 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007208
Domain Number 1 Region: 213-468
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.54e-51
Family Voltage-gated potassium channels 0.0016
Further Details:      
 
Domain Number 2 Region: 52-159
Classification Level Classification E-value
Superfamily POZ domain 1.02e-24
Family Tetramerization domain of potassium channels 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007208   Gene: ENSTTRG00000007621   Transcript: ENSTTRT00000007620
Sequence length 529
Comment pep:known_by_projection scaffold:turTru1:scaffold_113855:187589:191897:-1 gene:ENSTTRG00000007621 transcript:ENSTTRT00000007620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVKLLIQGTHLKNFWSRRILSTTLDSQRAAAMVSECPGPGARVPWRRSDEALRVNVGGVR
RRLSARALARFPGTRLGRLQAAASEEQARRLCDDYDAAAREFYFDRHPGFFLSLLHFYRT
GRLHVLDEQCVFAFGQEADYWGLGESALATCCRARYLERRVARPRVWDEDSDTLSSVGPC
PEEISDVQRELAHYRAVRCGRLRRRLWLTMENPGYSLPSKLFSCVSIGVVLASIAAMCIH
SLPEYQAREAAAAVAAVAAGRRAEGLRDDPVLRHLEYFCIAWFSFEVSSRLLLAPSTRNF
FCHPLNLIDIVSVLPFYLTLLAGVALQDRGGAGGEELGDLGKVVQVFRLMRIFRVLKLAR
HSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSCVAYTAEKEEDVGFDTIPACWWWGTV
SMTTVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNS
DHWEFEDLLSSVDGVSEASLETSRETSQEGRSEDLEAQATSGPPNSQVY
Download sequence
Identical sequences ENSTTRP00000007208 ENSTTRP00000007208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]