SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007230 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007230
Domain Number 1 Region: 57-189
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-46
Family Regulator of G-protein signaling, RGS 0.00000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007230   Gene: ENSTTRG00000007649   Transcript: ENSTTRT00000007643
Sequence length 195
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1408:82698:107303:-1 gene:ENSTTRG00000007649 transcript:ENSTTRT00000007643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLRNLSDYPVGKDPQAMRTGQRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRL
STEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLQFWLVCEEFKKPRSTAKLVSKA
HRIFEEFVDVQAPREVNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFLRS
KMYLDLLSQSQRRLS
Download sequence
Identical sequences ENSTTRP00000007230 ENSTTRP00000007230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]