SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007372 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007372
Domain Number 1 Region: 1233-1338
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-32
Family PDZ domain 0.00000446
Further Details:      
 
Domain Number 2 Region: 1636-1813
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.88e-28
Family Nucleotide and nucleoside kinases 0.00012
Further Details:      
 
Domain Number 3 Region: 496-608
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-16
Family PDZ domain 0.0024
Further Details:      
 
Domain Number 4 Region: 620-692
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-16
Family PDZ domain 0.025
Further Details:      
 
Domain Number 5 Region: 1499-1559
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000761
Family SH3-domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000007372
Domain Number - Region: 311-381
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.00484
Family Occludin/ELL domain 0.0027
Further Details:      
 
Domain Number - Region: 1450-1485
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0892
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007372   Gene: ENSTTRG00000007768   Transcript: ENSTTRT00000007796
Sequence length 1816
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1943:30707:107524:-1 gene:ENSTTRG00000007768 transcript:ENSTTRT00000007796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STYSVLSIMPSDSESSSSLSSVGTTGKAPSPPPLLTDRQVNEKVENLSIQLRLMTRERNE
LRKRLAFATHGTTFDKRPYHRLNPDYERLKIQCVRAMSDLQSLQNQHTNALKRCEEVAKE
TDFYHTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVLKHNGSSEILNKLYDTAMDKLEVVKKDYDALRKRYSEKVAVHSSDLSRLEQLE
EENQRLLKQTEMLTQQRDTAIQLQHQCALSLRRFEAIHHELNKATAQNKDLQWEMELLQS
ELTELRTTQAKTAKESEKYKEERDAVYSEYKLIMSERDQVISELDKLQTEVELAESKLKS
STSEKQAASEEMEALRQIKDTVTMDVGRANKEAEILRKQCKALCQELKEALQEADVAKCR
RDWAFQERDKIVAERDSIRTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKEL
KEQMESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALGFDMAEG
VNEPCLPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLINKDKKQAMKALLNGEGAI
NMVVRRRKSLGGKVVTPLHINLSGHKDSGISLENGVYAAAVVPGSPAAKEGSLAVGDRIV
AINGIALDNKSLNECESLLRSCQDSLTLSLLKVFPQSASWSGQNIFENIKDSDKMLSFRA
HGPEVQAQNKRNLMQHNNSTQTDIFYADRLEDRKESGPPGGSSSFLHKPFPGGTFPGSPQ
ACPSASERSLSPFRSDASGERGSGPVDVRSRRPLLPFETEVGPCGEAEARLDKAEPENAN
SGGTWPKAVLSSAAGPEKLSVYKKPKQRKSIFDPNTFKRPQTPPKIDYLLPGPGPAYSPL
PSKRVGPLTPPKPPRRGDSIKFQHKLETSSESEATLVGSSPSTSPPSALPPDMDPGEPMH
ASPPRKARVRIASSYYPEGDGDSSYLPAKKSCDEDLTSQKMDELGQMRRRPKSAPSFRPK
LAPVVISAQFLEEQKSVPASGELSPDLQEWSPYSPGHSSRHSNPPFYPSRASVGTVPRSM
TPSTTVSSVLRNPIYTVRSHRVGPCSSPPVPREAGPQGLHPSVQHQGRLSLDLSPRACSD
CSEMRASHGCNSLPSSARLGSSSNLQFKAERIKIPSTPRYPRSVVGSDRGSLSHSECSTP
PQSPLNVEGLSSCSPSQTSAATLPRIAVNPAALGERRKDRPYVEEPRHVKLQKGSEPLGI
SIVSGEKGGVYVSKVTGGSIAHQAGLEYGDQLLEFNGINLRSATEQQARLIIGQQCDTIT
ILAQYNPHMHQLSGHSRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXYGSLDVRNKTVEEVYVEMLKPKDSVRLKVQYRPEEFTKVKGLPGDSFYIRAYE
RQAEVEHELSFKKDDILYVDDTLPQGSFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSR
RLSMSEVKDDNTTAKTLSAAARRSFFRRKHKHKRSGSKDGRDLLALDTFSNDSIPLFEDS
VSLAYQRVQKVDCTSLRPVLILGPLLDVVKEMLVNEVPGKFCRCPLEVMKASQQAIERGV
KDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDVAPHAIERLHHMHIYPIVIFIHYK
SAKHIKEQRDPIYLKDKVTQRHSKEQFETAQKIEQEYSRFFTGVVQGGALSSICAQILAM
VNQEQNKVLWIPASPL
Download sequence
Identical sequences ENSTTRP00000007372 ENSTTRP00000007372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]