SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007434 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007434
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily PDZ domain-like 3.73e-25
Family PDZ domain 0.0000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007434   Gene: ENSTTRG00000007864   Transcript: ENSTTRT00000007859
Sequence length 140
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1046:67325:69107:-1 gene:ENSTTRG00000007864 transcript:ENSTTRT00000007859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSRIPYDDYPVVFLPAYENPPAWIPPHERVYHPDYNNELTQFLPRIITLKKPPGAQLGF
NIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREI
SMRVRFFPYNYHRQKERTVH
Download sequence
Identical sequences G3T6V6
ENSETEP00000007010 ENSLAFP00000009287 ENSTTRP00000007434 ENSETEP00000007010 ENSLAFP00000009287 ENSTTRP00000007434 XP_003412784.1.64505 XP_004329634.1.83887 XP_004716744.1.18182 XP_006868582.1.41390 XP_007121974.1.24612 XP_008154185.1.99482 XP_010591032.1.64505 XP_012390643.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]