SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007453 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007453
Domain Number 1 Region: 136-269
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000459
Family CBS-domain pair 0.0079
Further Details:      
 
Domain Number 2 Region: 364-415,446-473
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000864
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007453   Gene: ENSTTRG00000007881   Transcript: ENSTTRT00000007879
Sequence length 530
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3419:382733:403436:1 gene:ENSTTRG00000007881 transcript:ENSTTRT00000007879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AERAAARRWRARRWAGCALGALLLLASLAQAALAVLLYRAAGQRAVPAVLGSAGLVFLVG
EVVPAAVSGRWTLALAPRALILSRLAVLLTLPVALPVGQLLELAARPGRLRERVLELARG
GSDPYSDLSKGVLPCRTVEDVLTPLEDCFMLDASTVLDFGVLASIMQSGHTRIPVYEDER
SNIVDMLYLKDLAFVDPEDCTPLSTITRFYSHPLHFVFNDTKLDAVLEEFKRGKSHLAIV
QKVNNEGEGDPFYEVLGLVTLEDVIEEIIKSEILDESEDYRDTVVKKKPVSLSAPQQKEE
FSLFKVSDDDYKVKISPQLLLATQRFLSREVDVFSPLRISEKVLLHLLKHPSVNQEVRFD
ESDRLAAHHYLYQRSQPVDYFILILQGRVEVEIGKEGLKFENGAFTYYGVSALTAPSSVH
QSPVSSLQSIRHDPLPEPAEGTRLSAYCPDYTVRALSDLQLIKVTRLQYLNALLATRAQA
VPQSPENADLQAVPGSQTRLLGDKTAAATGSSHSRPGLPAEESPGRNPGV
Download sequence
Identical sequences ENSTTRP00000007453 ENSTTRP00000007453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]