SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007541 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007541
Domain Number 1 Region: 8-198
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.16e-74
Family Proteasome subunits 0.00000000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007541   Gene: ENSTTRG00000007968   Transcript: ENSTTRT00000007968
Sequence length 246
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1950:198061:219842:1 gene:ENSTTRG00000007968 transcript:ENSTTRT00000007968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILTEAEIDAHLV
ALAERD
Download sequence
Identical sequences ENSPCAP00000006059 ENSTTRP00000007541 ENSTTRP00000007541 ENSPCAP00000006059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]