SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007566 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007566
Domain Number 1 Region: 182-446
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.61e-77
Family Protein kinases, catalytic subunit 0.000000000278
Further Details:      
 
Domain Number 2 Region: 77-213
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-34
Family SH2 domain 0.00000184
Further Details:      
 
Domain Number 3 Region: 11-102
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-17
Family SH3-domain 0.0000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007566   Gene: ENSTTRG00000007997   Transcript: ENSTTRT00000007996
Sequence length 450
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3560:527226:531447:1 gene:ENSTTRG00000007997 transcript:ENSTTRT00000007996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLCPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIIYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFFRSGWALNMKDLKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
Download sequence
Identical sequences ENSTTRP00000007566 XP_004276359.1.21590 XP_004312179.1.83887 XP_019805202.1.83887 ENSTTRP00000007566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]