SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007577 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007577
Domain Number 1 Region: 16-192
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 8.37e-58
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007577   Gene: ENSTTRG00000008007   Transcript: ENSTTRT00000008007
Sequence length 204
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3560:697030:715163:1 gene:ENSTTRG00000008007 transcript:ENSTTRT00000008007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRATCSAAAPLVKRPFRVLVGVTGSVAALKLPLLVSRLLDIPGLEVAVVTTERAKHFY
SPQDVPVTLYSDADEWEMWKCRSDPVLHIDLRRWADLMLVSPLDANTLGKVASGICDNLL
TCVIRAWDRSKPLLFCPAMNTAMWEHPITEQQVGQLKAFGYVEIPCVAKKLVCGDQGLGA
MAEVGTIVDKVKEVLSQHGGFQQN
Download sequence
Identical sequences ENSTTRP00000007577 ENSTTRP00000007577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]