SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007687 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007687
Domain Number 1 Region: 278-462
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-49
Family Nucleotide and nucleoside kinases 0.00000668
Further Details:      
 
Domain Number 2 Region: 137-269
Classification Level Classification E-value
Superfamily SH3-domain 1.09e-32
Family SH3-domain 0.00099
Further Details:      
 
Domain Number 3 Region: 67-153
Classification Level Classification E-value
Superfamily PDZ domain-like 1.18e-19
Family PDZ domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007687   Gene: ENSTTRG00000008120   Transcript: ENSTTRT00000008123
Sequence length 466
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2195:95758:117587:-1 gene:ENSTTRG00000008120 transcript:ENSTTRT00000008123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLKASEGESGGAMRTALSDLYLEHLLQKRSRPETVSPQLSAVTEDMYTNGPAAPGSPTR
AQGQEARKVRLIQFEKVTAEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEI
NGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQNRLPALQMFMRAQFDYDPKKDNLIPCK
EAGLKFVTGDVIQIINKDDSNWWQGRVEGSSQGSAGLIPSPELQEWRVASGAQSAPSEAP
SCSPFGKKKKYKDKYLAKHSAIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKS
ALLSQSPDKFAYPAPYTTRPAKKSEEDGKEYHFISTAEMTRSIAANEFLEFGSYQGNMFG
TKFETVHQIHEQDKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSE
AIRGQYAHYFDLSLVNNSVDETLKKLQEAFDRACSSPQWVPVSWVY
Download sequence
Identical sequences XP_019793018.1.83887 ENSTTRP00000007687 ENSTTRP00000007687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]