SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007726 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007726
Domain Number 1 Region: 35-617
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.44e-161
Family Prokaryotic type I DNA topoisomerase 0.0000154
Further Details:      
 
Domain Number 2 Region: 652-688
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000272
Family PhnA zinc-binding domain 0.043
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000007726
Domain Number - Region: 971-1001
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00361
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007726   Gene: ENSTTRG00000008163   Transcript: ENSTTRT00000008163
Sequence length 1003
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2712:219386:244104:-1 gene:ENSTTRG00000008163 transcript:ENSTTRT00000008163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFPVVRRALTWLQRPGSRALTLADMEVALRGVRKILCVAEKNDAAKGIADLLSGGRMRR
REGLSRFNKIYEFDYCLRGQNVTMIMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEK
YCPENFLDIKKTLEREARQCQVLVIWTDCDREGENIGFEIIHVCKAVKPSLHVLRARFSE
ITARAVQAACENLMEPDRRVSDAVDVRQELDLRIGAAFTRFQTLRLQKIFPEVLAEQLIS
YGSCQFPTLGFVVERFKAIQAFVPETFHRIRVTHDHRDGAVEFSWKRHRLFNHTACLVLY
QLCMEDPRATVVEVRSKAKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYI
SYPRTETNIFPKDLDLTALVEEQTHDPRWGPFAQSILERGGPTPRNGNKSDQAHPPIHPT
KYTDSLQGDEQRLYELIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLVILARNYLDV
YPYDRWSEKTLPVYSRGSCFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAE
HIETIKARMYVGLTPDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKK
DKLVVLQQQVQKYKQVFIEAMAKAQRLDEALSQYFGAGVELAQQEAIFPAVPEPVRKCPQ
CGKDMVLKTRKSGGFYLSCTGFPECRSAVWFPDSVLEASRDGSVCPVCQPHPVYRLKFKF
KRGSLPPTMPLEFVGCVGGCDETLREILDLRFSRGPTRAGQPVSQPSGHLQASQPLDRMG
SSQHGHPQPPAIRPSNALARTAPLPAAEGEGNSVTCNCGREALLLTVRKEGPNQGRQFYK
CSGGGCSFFLWADSGHPEAGGPPSEVPRPPGGSLGRPPGSGKPLGGPGSPGDGGGGARCL
CSQPAVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENVAPGTFGGPPWAGARGGSR
EPEARSKRARAGSSDAGSAAKKPRKCSLCHQPGHTRPFCPQNR
Download sequence
Identical sequences ENSTTRP00000007726 ENSTTRP00000007726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]