SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007785 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007785
Domain Number 1 Region: 419-529
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-31
Family SH2 domain 0.000000732
Further Details:      
 
Domain Number 2 Region: 97-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.32e-29
Family Ras-binding domain, RBD 0.00000885
Further Details:      
 
Domain Number 3 Region: 230-343
Classification Level Classification E-value
Superfamily PH domain-like 8.77e-16
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007785   Gene: ENSTTRG00000008222   Transcript: ENSTTRT00000008222
Sequence length 532
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3558:113963:117992:1 gene:ENSTTRG00000008222 transcript:ENSTTRT00000008222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGLSPPHLSSSPEDLYLAPGTPPGTPPPPDVPLSGEVKRSQPLPIPTSRKLLRQEELR
STSLPSIPNPFPELCSPPSQTPILGGPSSARGLLPRDTSCPHVIKVYSEDGACRSVEVAA
GATARYVCEMLVQRSHALSDENWGLVEGHPHLALERVLEDHESVAEVQAAWPIGGDSRFL
FRKNFAKYELFKNTPHSLFPEKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRG
SGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFG
FCIKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQALCRHLRPPCVG
SPPLRSVSDNTLVAMDFSGHAGRVIENPREALSAALEEAQAWRKKTNHRLSLPTPSSGTS
LSAAIHCTQPWFHGRISREESQRLIGQQGLVDGVFLVRESQRNPQGFVLSLCHVQKVKHY
LIMPSEEEGRLYFSMDEGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL
Download sequence
Identical sequences ENSTTRP00000007785 ENSTTRP00000007785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]