SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007797 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007797
Domain Number 1 Region: 65-370
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.63e-86
Family Protein kinases, catalytic subunit 0.000000000114
Further Details:      
 
Domain Number 2 Region: 338-358,433-553
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-46
Family Pleckstrin-homology domain (PH domain) 0.00000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007797   Gene: ENSTTRG00000008234   Transcript: ENSTTRT00000008234
Sequence length 558
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1270:355472:419888:1 gene:ENSTTRG00000008234 transcript:ENSTTRT00000008234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTTSQLYDTVPIQSSVVLCSCPSPSMVRTQTESSTAPGVPSCGSRQGPTMDSTTAESR
PSANSLQHATQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI
IKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFD
ETCTRFYTAEMVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQAR
ANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESIMWENLHHQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSAADAGLPQRVGSNIEQYIHD
LDTNSFELDLQFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLL
TEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKK
IQEVRRHRYQSHPDAAVQ
Download sequence
Identical sequences ENSTTRP00000007797 ENSTTRP00000007797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]