SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007856 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007856
Domain Number 1 Region: 376-604
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-60
Family DBL homology domain (DH-domain) 0.000000723
Further Details:      
 
Domain Number 2 Region: 90-213
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.65e-40
Family Regulator of G-protein signaling, RGS 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007856   Gene: ENSTTRG00000008288   Transcript: ENSTTRT00000008294
Sequence length 838
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3049:40050:56558:1 gene:ENSTTRG00000008288 transcript:ENSTTRT00000008294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGPSSSPSPAEPMEAEDVARGAAPGPPRPGLVPISIIGAEDEDFENELKTXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXILRVTVPPTVAFELDRTRPDLLSEDVQRHFLQ
EVVQTQQAAVSRQLEDFRSKKLMGMTPWEQELIQLGAWVGRDRATYEARERHLAERQLAH
LEDMQHTISNDEEKSAAVVSAITLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSEEPTK
TKKGLSSFLDAARWNRGEPQAPDFRHLKVEADGEKPGLTERKGGLGVPSRDRNVGAPGQD
TPGVSLHPLSGDSPDREPGVDALPELGDPPPQGPASLEPAAPLESAEEGADTESPEPGDE
GEPGRLGLELEPEEPPGWRELVPPGTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLYD
LFYQPMADGGFFSLEELQNIFPSLDELIEVHSLFLDRLMKRRQDSGYLIEEIGDVLLAQF
DGTEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQEAESRPRCRRLQLKDMIPT
EMQRLTKYPLLLQSIGQNTEEPAEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQR
RLDLSHLRQSSDPMLSEFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPA
DGRMERIFSALLPFCRPGPEGQLAARALQKGGGGGVLPPETPPVSARGEHCPPFWLYL
Download sequence
Identical sequences ENSTTRP00000007856 ENSTTRP00000007856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]