SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007910 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007910
Domain Number 1 Region: 44-121
Classification Level Classification E-value
Superfamily Homeodomain-like 2.82e-26
Family Homeodomain 0.0000579
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000007910
Domain Number - Region: 125-243
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0706
Family Phosphate binding protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007910   Gene: ENSTTRG00000008349   Transcript: ENSTTRT00000008349
Sequence length 289
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1034:34576:36185:-1 gene:ENSTTRG00000008349 transcript:ENSTTRT00000008349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFGLLSEAEARSPALSLSDAGTPHPPIPEHGCKGQEHSDSEKASVSLPGGSPEDSSLKK
KQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKR
ERSQQAELCKGGFAAPLGGLVPTYEEVYPGYSYGNWPPKALVPPLSIKTFPFAFNSVNMG
TLASQTVISPPSSITTSMIPSATTAQGTVPGHGTLQDLVGSGAVSPYASAAAAAAAAASS
PYVYRDPCNSSLALRLKAKQHATFSYPAVPGPPPAANLSPCQYAVERPV
Download sequence
Identical sequences ENSTTRP00000007910 ENSTTRP00000007910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]