SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007920 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007920
Domain Number 1 Region: 466-819
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.75e-111
Family PDEase 0.000000299
Further Details:      
 
Domain Number 2 Region: 58-252
Classification Level Classification E-value
Superfamily GAF domain-like 4.58e-30
Family GAF domain 0.00038
Further Details:      
 
Domain Number 3 Region: 238-442
Classification Level Classification E-value
Superfamily GAF domain-like 1.64e-17
Family GAF domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007920   Gene: ENSTTRG00000008359   Transcript: ENSTTRT00000008359
Sequence length 839
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1521:247213:304347:1 gene:ENSTTRG00000008359 transcript:ENSTTRT00000008359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEISQETVEKYLEDNPQFAKAYFDRKLRGEAAGEISEPGGAQAPARASFPGLTLMEEAA
LCLELLEALREEAGSVELAAHKALQRLAQLLRADRCSMFLCRARNGSPEVASKLLDVTST
SKFEDNLVVPDREVVFPLDVGIVGWVAHTKKTFNVPDVKKNSHFSDFMDRQTGYVTRNLL
ATPIVTGKEVLAVVMAVNKVDASEFSKRDEEVFSKYLSFVSVILKLHHTNYLYSIESRRS
QILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEPVKLGEV
ESYNCPKTSDGREVMFYKIIDYILHGKEEIRVIPTPPADHWTLISGLPTYVAENGFKGPV
DETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEYDEHITEXXXXXXXXXXLNTD
YEKMNKLVNRKDIAQEMLMNHTKATDEIKSILKFKEKLNIDVIEDCEENQLVTILKEDLP
DPQAVDLYEFRFSDFPITEHELIKCGLRLFLEINVVEKFKVPVEVLTRWMYTVRKGYRAV
TYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAFCHDIDHRGTNNLYQMKSTS
PLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFETVIHLFEVAIIATDLALYFK
KRTMFQKIVDACEKMETEEEAIKYVTIDPTKKEIIMAMMMTACDLSAITKPWEVQSQVAL
LVANEFWEQGDLERTVLQQQPIPMMDRNKDELKLQVGFIDFVCTFVYKEFSRFHKEIIPM
LNGLQNNRVEWKSLADEYDAKMKVNEEKKKQEEGNTTEKAAEDSGGGGDDKKSKTCLML
Download sequence
Identical sequences ENSTTRP00000007920 ENSTTRP00000007920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]