SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007985 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007985
Domain Number 1 Region: 19-225
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-44
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 256-453
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.74e-37
Family BAR domain 0.017
Further Details:      
 
Domain Number 3 Region: 602-672
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-18
Family SH3-domain 0.00059
Further Details:      
 
Domain Number 4 Region: 495-568
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000394
Family SH3-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007985   Gene: ENSTTRG00000008422   Transcript: ENSTTRT00000008424
Sequence length 675
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2575:805210:841140:1 gene:ENSTTRG00000008422 transcript:ENSTTRT00000008424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDHGDDELSSRTGSPDEEGRVPEERSLLHQSLAVRELIDTEVSYLHVLQLCALDIRSHL
QQLPQGDLDVLFSNIDDIIKVNSKLLHDLQETASREEEQVQLIGNLFLEFQEELEQVYKV
YCASYEQALLLVEAYRMEPQLQREIQDTIEAVLPQAGSSGLSFLLVIPLQRITKYPLLLQ
KILENTLPDASAYPVLQRATSALQDVVTNINEYKRRKEVASKYTKVEHLSLRERLARINM
HTLSKKTTRLGQLLKQEAGLVPKTEDKEFDDLEESFHWVSLCVTELKNNVAAYLDNLEAF
LRFRPQEYDLDIPGGPVVQYCYLARDLQLQTFPEFKQRLEALVWQPLCSLAKALAGPQNL
IKKRLDKLLDFERVEEKLLEVGSMTYEEEAARHMYEALNSLLVAELPQFKQLAVRWLGQI
LCTFVTLQRDLAKQVLQRAEGSLAQLPHHHLSDPAFRKLVEDALGQTSHQLHSFQENFEK
VLPPPTTQPLLPGAEHQVQALLSRYGPGKLYQVTSNISGSGTLDLTLPRGHVVALLQDKD
TKGNSSRWLVDTGGHRGYVPAGKLELYHVVPREEELRGQARXXXXXXXXXXXXXXXXXXX
XXXXXXVVAVYPFVARSSHEVSLQAGQQVTVLEAQDKKGNPEWSLVEVNGQRGYVPSSFL
ARAPGPALWGWSLPS
Download sequence
Identical sequences ENSTTRP00000007985 ENSTTRP00000007985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]