SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007998 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007998
Domain Number 1 Region: 563-592,631-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.28e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007998   Gene: ENSTTRG00000008441   Transcript: ENSTTRT00000008437
Sequence length 729
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2575:1157434:1161109:1 gene:ENSTTRG00000008441 transcript:ENSTTRT00000008437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKNKEQDDNSPPSRIHLEHEEESHNDFQQFETNDQCRPHARIHLEPQEKPDTNFKQFV
IKKLEKSCQCNSTKARNIIFGFLPVLQWLPKYNLKKNILGDVMSGLIVGILLVPQSIAYS
LLAGQEPVYGLYTSFFASFIYFLLGTSRHISVGIFGVLCLMIGEVVDRELYKAGYDTAHV
TSSLGVVSNESTLLSQPSGKICDKSCYAIIVGSTVTFMAGVYQVAMGFFQVGFVSVYLSD
ALLSGFVTGASFTVLTSQAKYLLGLSLPRSSGVGSLITTWIHIFRNIHKTNICDLITSLL
CLLVLLPTKELNERLKSKLKAPIPTELFVVVAATLASHFGKLNEKYNTSIAGHIPTGFLP
PKAPDWNLIPNVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYAIGFCNIIPSF
FHCFATSAALAKTLVKESTGCQSQLSGVVTALVLLLVLLVIAPLFYSLQKSVLGVITIVN
LRGALRKFKDLPEMWRISRMDTVIWFVTMLSSALISTEIGLLVGVCFSLFCVILRTQKPK
TSLLGVVEESEIFESMSAYKNLRAKPGIKIFRFVAPLYYINKEYFKSSLYKKTLNPVLVK
AAQKKAVKRKIKKETAPLSGIRDEVSVQLSHDPLEFHTIVVDCSAIQFLDTAGIHTLKEV
RRDYEAIGIQVLLAQCNPSVRDSLARGEYCKKEEENLLFYSVYEAMTFAEDSQNRKDIYV
PNGLSFSSD
Download sequence
Identical sequences ENSTTRP00000007998 ENSTTRP00000007998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]