SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008021 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008021
Domain Number 1 Region: 218-381,414-459
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.06e-33
Family Voltage-gated potassium channels 0.0052
Further Details:      
 
Domain Number 2 Region: 524-663
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-25
Family cAMP-binding domain 0.0028
Further Details:      
 
Domain Number 3 Region: 39-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-20
Family Flavin-binding PAS domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008021   Gene: ENSTTRG00000008461   Transcript: ENSTTRT00000008461
Sequence length 1106
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3085:264971:628536:1 gene:ENSTTRG00000008461 transcript:ENSTTRT00000008461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEV
MQKSCSCKFLFGVETNEQLMLQIEKSLEEKAEFKGEIMFYKKNGSPFWCLLDIVPIKNEK
GDVVLFLASFKDITDTKVKITPEDKKEDKAKGRSRTGTHFDSARRRSRAVLYHISGHLQR
XXXXXXXXXXNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVP
YNVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVT
TWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLM
SMFALLAHWMACIWYVIGKMEMEDNSLLKWEVGWLPELGKRLESPYYGNNTLGGPSIRSA
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLKDFPDELRSDITM
HLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLK
DSMVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHK
FVEDIQHDLTYNLREGHESDVISRLSNKSTVSQPEPKGNGSIKKRLPSIVEDEEEEESRE
EEETASLSPIYTRGSSSSRSKRPGSSKSYLGLSLKQLASGTVPFHSPVRVSSSNSPKSKQ
EADAPNHGKRKEKNLKLQLSALNNAGPPDLSPRVVDGIEDGNCSEESQSFDFGSERVRPE
PRISPPLGDPEIGAAVLFIKAEETKQQINKLNSEVTTLTQEVSQLGKDMRTVMQLLEHVV
SPQQPARFCSLHTTSVCPSSLQTRMTWSTHQPCLHLQAGGAAYTQAQLCHGNVTPDIWSV
DPSSVGSSPQRTGVYEQNPAGGELYHSPNLDYSPARYQVVQEGRLQFLRCISPQSDTTLM
PLQSISATLSSSVCSSSETSLHLVLPSRSEEGSLGQGAMSSFSLENLPGSWDREGRASIT
TEPSENFPLEVVTSPAEVKVTKAINV
Download sequence
Identical sequences ENSTTRP00000008021 ENSTTRP00000008021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]