SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008073 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000008073
Domain Number - Region: 28-93
Classification Level Classification E-value
Superfamily Flavoproteins 0.0109
Family NADPH-dependent FMN reductase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008073   Gene: ENSTTRG00000008528   Transcript: ENSTTRT00000008518
Sequence length 134
Comment pep:known_by_projection scaffold:turTru1:scaffold_114224:407332:439130:1 gene:ENSTTRG00000008528 transcript:ENSTTRT00000008518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMNEKQMYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEWTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCI
Download sequence
Identical sequences ENSTTRP00000008073 ENSTTRP00000008073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]