SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008090 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008090
Domain Number 1 Region: 139-545
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.41e-88
Family L-arabinose binding protein-like 0.00051
Further Details:      
 
Domain Number 2 Region: 73-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000334
Family Complement control module/SCR domain 0.0000406
Further Details:      
 
Domain Number 3 Region: 26-73
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000361
Family Complement control module/SCR domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008090   Gene: ENSTTRG00000008536   Transcript: ENSTTRT00000008535
Sequence length 928
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3483:99826:125229:-1 gene:ENSTTRG00000008536 transcript:ENSTTRT00000008535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTD
MDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVDFRCDSDFHLVGSSRSICSQGQ
WSTPKPHCQVRPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYEL
KLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSS
PALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVK
EAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWF
LIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLT
KRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYR
AMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGG
SPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNN
LTAVGCSLALAAVFPLGLDGYHIGRSQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTV
FTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDID
VSILPQLEHCSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYN
VAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYIPDVLFVPMRRLITRGEWQSEAQDT
MKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPD
PSGALPRGPPEPPDRLSCDGSRVHLLYK
Download sequence
Identical sequences ENSTTRP00000008090 ENSTTRP00000008090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]