SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008115 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008115
Domain Number 1 Region: 166-357,456-604
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.77e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000151
Further Details:      
 
Domain Number 2 Region: 48-150
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.06e-22
Family Anticodon-binding domain 0.00036
Further Details:      
 
Domain Number 3 Region: 335-461
Classification Level Classification E-value
Superfamily GAD domain-like 7.2e-18
Family GAD domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008115   Gene: ENSTTRG00000008559   Transcript: ENSTTRT00000008560
Sequence length 639
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_978:388556:409091:1 gene:ENSTTRG00000008559 transcript:ENSTTRT00000008560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCWLSRLYRGLSRPTRRTTQLIWGSFSRSLVLSSQRRIPELSSFVARTNTCGELRSSHL
GQEVTLCGWNQYRRQNIFLVLRDFHGLVQVIIPQDESAASVKKILCEAPMESVVQVSGTV
ISRPPGQENPKMPTGEIEIKVKTAKLLNSCKKLPFEIKDFVKKTEALRLRYRYLDLRGVQ
MQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFVIPSREPGKFYSLPQS
PQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVEQTGIQSLIEGLLQ
YSWPSDRDPVVVPFPSMTFAEALASYGTDKPDTRFGMKIVDISDMFRNTEVGFLQDALSK
PQGTIKAICIPEGEKYLKRKDIESIRKFAADHFNQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXLLETQEEDVVLLTAGEHKKACSLLGKLRLECADLLEARGVALRDPALFSFLWVV
DFPLFFPKEENPEELETAHHPFTAPHPSDIHHLYTEPQKVRSQHYDLVLNGSEIGGGSIR
IHDAELQHYILATVLKEDVKLLSHLLQALDYGAPPHGGIAIGLDRLMCLVTGASIRDVIA
SPSFQGHDMSNAPDSIPEELKPYHIQVSWPTDSETKRVH
Download sequence
Identical sequences ENSTTRP00000008115 ENSTTRP00000008115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]