SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008132 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000008132
Domain Number - Region: 72-146
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0787
Family cAMP-binding domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008132   Gene: ENSTTRG00000008582   Transcript: ENSTTRT00000008577
Sequence length 230
Comment pep:known_by_projection scaffold:turTru1:scaffold_93553:1941:4738:1 gene:ENSTTRG00000008582 transcript:ENSTTRT00000008577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTNASPLHPYWPRHLRLDNFVPNDCPTWHLLAGLFSISGVLVVTTWLLSGHAAVIPLGT
WRRLSLCWFAVCGFIHLVIEGWFSLYHEDLLGDQAILSQLWKEYAKGDSRYILNDSFMIC
METITACLWGPLSLWVVIAFLRQQPLRFVLQLVVSVGQIYGDVLYFLTEHREGFQHGELG
HPLYFWFYFVFLNALWLVLPGILVLDSIKQLARAQSMLDTKATKAKSKQN
Download sequence
Identical sequences ENSTTRP00000008132 ENSTTRP00000008132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]