SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008185 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008185
Domain Number 1 Region: 437-572
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.51e-49
Family Transglutaminase core 0.0000159
Further Details:      
 
Domain Number 2 Region: 698-795
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.76e-27
Family Transglutaminase, two C-terminal domains 0.00067
Further Details:      
 
Domain Number 3 Region: 586-697
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.76e-27
Family Transglutaminase, two C-terminal domains 0.00072
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily E set domains 5.95e-20
Family Transglutaminase N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008185   Gene: ENSTTRG00000008634   Transcript: ENSTTRT00000008634
Sequence length 824
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3576:244664:258439:-1 gene:ENSTTRG00000008634 transcript:ENSTTRT00000008634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTGSPRSDVGRWGGNPWQPLVTPSPEPEPEPDRHARHGRRPFWARCCGCCSCQNTIDEDW
GPEPGGDHGSNSRPRRPSPRDRRPDTPGGRPNTLGRRPDSRGSTVTTARDDTIQEGKLVV
TGVDLLSSPSDQNRQEHHTDEFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN
NPEVGKGTHVIIPVGQGGSGGWNAQVTKSSGKNLNLQVHTSPNAIIGKFQFTVRTCSEAG
EFQLPFDPCNEIYILFNPWCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXHDSVWNFHVWNDCWMKRPDLPPGFDGWQVVDATPQETSSGIFC
CGPCSVESVKNGLVYMKYDTPFIFAEVNSDKIYWQRQGDGSFKVVYVEEKAIGSLVVTKA
VGSNMREDVSHIYKHPEGSEAERKAVETAAAHGSKPNVYAIRDSAEDVALKVEAQDAVMG
QDLTICVVLTNCGSSPRTVKLHLYLSVTYYTGVSGSVFKESKKEVVLAPGASERMAMPVA
YKEYRVHLVDQGAMLLNISGHVKENTQVLAKQHTFRLRTPDLTLTLLRAAVVGQVCEVQI
VFQNPLPITLTNVVFRLEGSGLQRPKTLNAGDIEGNKRVTLRQTFVPVRPGCRQLIASLD
SPQLSQVHGVIQVDVALAAGGGGSSDTRGNGSSEETIPIASGGA
Download sequence
Identical sequences ENSTTRP00000008185 ENSTTRP00000008185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]