SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008205 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008205
Domain Number 1 Region: 28-257
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.57e-68
Family Eukaryotic proteases 0.0000000513
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008205   Gene: ENSTTRG00000008662   Transcript: ENSTTRT00000008656
Sequence length 260
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2363:260897:268048:1 gene:ENSTTRG00000008662 transcript:ENSTTRT00000008656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNSSTFLAATLSMVIFLLLIPEDLCVKIIGGNEVTPHSRPYMVLLQDKSICAGALIARD
WVLTAAHCNVNRRSQIVLGAHSITKKEPEKQIMFVKKVFPYPCYDQDTHEGDLKLLQLNK
KATINKNVAILTLPKLGDDVKPGTMCRVAGWGRFHNNSPRSDILREVNVTVIDRKICNDP
SHYNYNPVIGLNMICAGSLKGGRDSCSGDSGSPLICEGIFRGITSFGLPGKCGDPRGPGV
YTLLSKKHLSWIAKTMKHAV
Download sequence
Identical sequences ENSTTRP00000008205 ENSTTRP00000008205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]