SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008214 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008214
Domain Number 1 Region: 42-127
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000119
Family FHA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008214   Gene: ENSTTRG00000008668   Transcript: ENSTTRT00000008665
Sequence length 185
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2826:152693:153250:-1 gene:ENSTTRG00000008668 transcript:ENSTTRT00000008665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNFEDADTEETVTCLQMTVYHPGHQQNGIFQSIRFFNREKLPSNEVVKFGRNSNTCHYT
FKDKQVSRVQFSLQLFKKFDSSVLSFEIKNMSKKTKLIVDNKELGYLNKMDLPHKCLVRF
GDYQFLMEKEDGESLQFFEIEFSLSTRPLLQENNWLPQKHIPECGSYSSCSTQNNSPIEM
GENEW
Download sequence
Identical sequences ENSTTRP00000008214 ENSTTRP00000008214 XP_004316973.1.83887 XP_019783385.1.83887 XP_019783386.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]