SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008317 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008317
Domain Number 1 Region: 64-352
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.74e-115
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000118
Further Details:      
 
Domain Number 2 Region: 366-478
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.37e-26
Family Anticodon-binding domain of Class II aaRS 0.000000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008317   Gene: ENSTTRG00000008785   Transcript: ENSTTRT00000008772
Sequence length 482
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3058:61310:75077:-1 gene:ENSTTRG00000008785 transcript:ENSTTRT00000008772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCGAAVRAGQKVCRCLLSGFSRVDGRQLTEGSGSFVGPLRSHGELPPVSELREGPESGG
EESEVLVEICQKRRFLSGTKRQLSRDSLLSGCHPGLGPLGIELRKNLAAEWWSAVVVFRE
QVFPVDALYHEPGPSLPGDSAFRLVSAETLREILQDKELSKEQLGAFLENLLKTSGKLRE
NLLHGALEHYVNYLDLLNKRLPFGLAQIGVCFHPVSDTKQTPDGVKRIGEKTEASLVWFT
SARTASQWLDFWLRHRLLWWRKFAVSPSNFSSSDCQDEAGRKGNKLYYNFPWGKEPIETL
WNLGDHELLRMYPENVAQLHGRDGRKNVVPSVLSINGDLDRGMLAYLYDSFQLTENSFTR
KKDLHRKVLKLHPCLAPIKVALDVGRGPTVELRQVCQGLFNELLENGISVWPGYLETVPS
SLEQLYSKYDEMSILFTVLITEATLENGLIHLRSRDTTMKETMHISKVKDFLTKYISSAK
NV
Download sequence
Identical sequences ENSTTRP00000008317 XP_019799961.1.83887 ENSTTRP00000008317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]