SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008375 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008375
Domain Number 1 Region: 241-443
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 6.28e-31
Family Sec63 N-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 101-203
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.66e-25
Family Chaperone J-domain 0.00091
Further Details:      
 
Domain Number 3 Region: 628-717
Classification Level Classification E-value
Superfamily E set domains 5.6e-19
Family Sec63 C-terminal domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008375   Gene: ENSTTRG00000008813   Transcript: ENSTTRT00000008833
Sequence length 759
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_830:365400:434329:-1 gene:ENSTTRG00000008813 transcript:ENSTTRT00000008833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQNRLKNIRKVYGRCMWYR
LRLLKPQPNIIPTVKKIVLLAGWALLLFLTYKVSKTDREYQEYNPYEVLNLDPGATVAEI
KKQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALP
AWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRN
MDMKRLIMVLAGASEFDPQYNKDATSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLK
ARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQKMVTVICQLIIMARSREEREFRAPTL
ASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDR
HNLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
EVFEKEQSICAAEEQPAEDGQGDTNKNRTKGGWQQKSKGPKKTAKSKKKKPLKKKPTPVP
LSQPKQQKQKQANGVVGSEAAVKEDEEEVSDKGSDSEEEETNRDSQSEKDDGSDRDSDRE
QDEKQNKDDEAEWKELQQSIQRKERALLETKSKITHPVYSLYFEEKQEWWWLYIADRKEQ
TLISMPYHVCTLKDMEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAKP
VPENHPQWDTAVEGDEDQEDSEGFEDSFEEEEEEEEDDD
Download sequence
Identical sequences ENSTTRP00000008375 ENSTTRP00000008375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]