SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008461 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008461
Domain Number 1 Region: 95-196
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.5e-30
Family Iojap/YbeB-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008461   Gene: ENSTTRG00000008920   Transcript: ENSTTRT00000008920
Sequence length 234
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1431:64862:83427:1 gene:ENSTTRG00000008920 transcript:ENSTTRT00000008920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRGCVALRLGVLLWRRAFSPGAWPAAAAGLRLRLLSVGRLPVGPTLGKVCPAPDRARG
LHGGPGLEERAEGTAGEGRPESGTGDHTGPKFDIDMLVSLLRQENARDICVIKVPPEMKY
TDYFVIGSGTSTRHLHAMAYYIVKMYKYLKHKSEPHVKIEGKDTDDWLCVDFGSMVIHLM
LPETRETYELEKLWTLRSYDDQLAQIAPETLPEDFILGIEDDTSSLAPVEFKCE
Download sequence
Identical sequences XP_019784272.1.83887 ENSTTRP00000008461 ENSTTRP00000008461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]