SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008483 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008483
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.14e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 441-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 135-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000117
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000008483
Domain Number - Region: 96-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0581
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008483   Gene: ENSTTRG00000008947   Transcript: ENSTTRT00000008945
Sequence length 505
Comment pep:known_by_projection scaffold:turTru1:scaffold_82641:8520:13777:1 gene:ENSTTRG00000008947 transcript:ENSTTRT00000008945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESQESVTFKDVAVDFTQEEWALLDTSQRKLFRDVMLENISHLVSVGNQLYKSDVISHLE
QGEQLSREELGFLQGREDDLRKQEMISMQHIYKKGTSVISAMRSHSQEDLLECNDFREKF
TEILTLTQYVIPQVGKKPFFSQDFGKAISYLSSFNIHKQIHARSKSYECHQRTNAFIQSS
ALRQHDNTQTGEKTFECHVCRKAFSKSSNLRRHEMIHTGVKPHGCHLCGKSFTHCSDLRK
HERIHTGEKLYGCHLCGKAFSKSYNLRRHEMIHTREKPNECHLCGKAFTHCSDLRKHERT
HFGEKPYGCHLCGKTFSKTSYLRQHERTHNGEKPYECHLCGKAFTHCSHLRKHERTHTGE
KPYECHLCGKAFTESSVLRRHERTHTGEKPYECHLCWKAFTDSSVLKRHERTHTGEKPYE
CHLCGKAFNHSSVLRGHERTHTGEKPYECNICGKAFNRSYNFRLHKRIHTGEKPHKCYLC
GKAFSKYFNLRQHERTHAVKVVNVE
Download sequence
Identical sequences ENSTTRP00000008483 ENSTTRP00000008483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]