SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008531 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008531
Domain Number 1 Region: 502-817
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.77e-76
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 129-243
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-34
Family Spermadhesin, CUB domain 0.0000137
Further Details:      
 
Domain Number 3 Region: 289-397
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-24
Family Spermadhesin, CUB domain 0.0000577
Further Details:      
 
Domain Number 4 Region: 401-471
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000709
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 239-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000099
Family EGF-type module 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008531   Gene: ENSTTRG00000008994   Transcript: ENSTTRT00000008995
Sequence length 829
Comment pep:known_by_projection scaffold:turTru1:scaffold_92511:48486:95288:-1 gene:ENSTTRG00000008994 transcript:ENSTTRT00000008995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQPYGMKEGPGEADLLRKKTDSVVRFLCVYEQVREEREGKGRGREGERGSVAGRGRRDLN
GECQPIPETHRDLRTKIRHRHHTGDELADKSGRGDQAARSTQGRKMRWLLLSHALCFSLL
KALAHIVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPEGFRIKLYFMHFNLESSYLCEY
DYVKVETEEQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFEAHY
MAVDVDECMEQEDEELSCDHYCHNYIGGYYCSCRVGYILHTDNRTCRVECSDNLFTQRTD
VITSPDFPSPYPSSECVYTIELEEGFMILQEDIFDIEDHEVSCPYDYIKIKTGPKVLGPF
CGEKAPEPINTQSHSVQILFRSDNSGENRGWRLLYRATGNECPKLQPPVHGNIEPLQAKY
FFKDQVLISCDTGHKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCGAPAELENGLVT
FSTRNNLTTYKSEIRYSCQQPYYKMLHSITDVYTCSAQGVWMNEVLGRSQPTCLPACGQP
SRSLPNLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSESWILTAAHVL
RSQRRDNTVTPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFDIQNYNHDIALVQL
REPVPLGPHIMPVCLPRPEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQY
VKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVILDDSSQRWV
AQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQIGSPQGLGELQVER
Download sequence
Identical sequences ENSTTRP00000008531 ENSTTRP00000008531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]